PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016648488.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 371aa    MW: 42052 Da    PI: 7.8059
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016648488.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.75.5e-54111411129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeel+ +yL+kkv+ + ++l +vi+evd++k+ePwdL++  ++ +  ++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk++
  XP_016648488.1  11 VPPGFRFHPTDEELLYYYLRKKVSYEAIDL-DVIREVDLNKLEPWDLKEkcRIGSgPQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKAI 104
                     69****************************.9***************952444443456************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     + ++++ +g++ktLvfy+grap+g+ktdW+mheyrle
  XP_016648488.1 105 HLANSKRIGMRKTLVFYTGRAPHGQKTDWIMHEYRLE 141
                     ***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.54E-585171IPR003441NAC domain
PROSITE profilePS5100556.48811171IPR003441NAC domain
PfamPF023655.1E-2812140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010455Biological Processpositive regulation of cell fate commitment
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MMASGNGQLT VPPGFRFHPT DEELLYYYLR KKVSYEAIDL DVIREVDLNK LEPWDLKEKC  60
RIGSGPQNEW YFFSHKDKKY PTGTRTNRAT TAGFWKATGR DKAIHLANSK RIGMRKTLVF  120
YTGRAPHGQK TDWIMHEYRL EDDNISADQV QVVGLLVXXX XGWVVCRVFK KKNHNRGYQP  180
EFAHHQDQEH DHFTNMKASG SHAPVLLEHH EPKQNHHHLE ALYDYTSNFD HAGSMHLPQL  240
FSPESAVASS FVSPNTINLN TMDIECSQNL LRLTSTAAAA AAAAAGCGQL MQQQERSLIN  300
GGDWSFLDKL LASHQSLDHH HSSHTKCNNP SSSAQHQLNN SHEHVGTSST TQQRFPFQYL  360
GCGTDLLKFS K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-50717411171Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00250DAPTransfer from AT1G79580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008225961.10.0PREDICTED: protein SOMBRERO
SwissprotQ9MA171e-125SMB_ARATH; Protein SOMBRERO
TrEMBLM5WZ810.0M5WZ81_PRUPE; Uncharacterized protein
STRINGVIT_19s0085g01210.t011e-169(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72043447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.31e-112NAC family protein